PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G1089
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 353aa    MW: 38718.9 Da    PI: 7.1521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G1089genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ + + g+ R++k+c++rw +yl
      Gh_D10G1089 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPVKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding521.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
      Gh_D10G1089  67 RGKFSMQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.858961IPR017930Myb domain
SuperFamilySSF466891.5E-3011108IPR009057Homeodomain-like
SMARTSM007179.7E-141363IPR001005SANT/Myb domain
PfamPF002495.4E-161461IPR001005SANT/Myb domain
CDDcd001672.59E-111661No hitNo description
PROSITE profilePS5129425.53662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2665116IPR009057Homeodomain-like
SMARTSM007171.3E-1566114IPR001005SANT/Myb domain
PfamPF002497.0E-1667112IPR001005SANT/Myb domain
CDDcd001674.83E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PVKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SMQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKLG  120
IDPITHKPKS DALLSTDAQS KSAANLSHMA QWESARLEAE ARLVRESKLR SHSHSHSFQH  180
RLTRPPTAAF ASSAGQLVNK TAWNSTAGWS KSSEVNNGVV NNGFGDLESP KSTLTSSENG  240
VGLSSMGMPD FVGTASASSE IKQEGEQEWK GFGSSTNLAM ENGFNDIGNA MEDGFINLLL  300
NDSTDPSLSD SGKESDGNSG DGTASDDHYE DNKNYWNSIL DLVNSSPSGS PMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.225150.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012457053.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0D2US330.0A0A0D2US33_G
STRINGPOPTR_0017s12230.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-129myb domain protein 16